PDB entry 1lpj

View 1lpj on RCSB PDB site
Description: human crbp iv
Deposited on 2002-05-08, released 2003-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lpja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpjA (A:)
    padlsgtwtllssdnfegymlalgidfatrkiakllkpqkvieqngdsftihtnsslrny
    fvkfkvgeefdednrgldnrkckslviwdndrltciqkgekknrgwthwiegdklhlemf
    cegqvckqtfqra