PDB entry 1lpf

View 1lpf on RCSB PDB site
Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
Deposited on 1992-10-26, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.192
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpfA (A:)
    sqkfdvvvigagpggyvaairaaqlglktaciekyigkegkvalggtclnvgcipskall
    dssykyheakeafkvhgieakgvtidvpamvarkanivknltggiatlfkangvtsfegh
    gkllankqvevtgldgktqvleaenviiasgsrpveippaplsddiivdstgalefqavp
    kklgvigagviglelgsvwarlgaevtvlealdkflpaadeqiakealkvltkqglnirl
    garvtasevkkkqvtvtftdangeqketfdklivavgrrpvttdllaadsgvtldergfi
    yvddhcktsvpgvfaigdvvrgamlahkaseegvmvaeriaghkaqmnydlipsviythp
    eiawvgkteqtlkaegvevnvgtfpfaasgramaandttglvkviadaktdrvlgvhvig
    psaaelvqqgaigmefgtsaedlgmmvfshptlsealheaalavnghaihia
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpfB (B:)
    sqkfdvvvigagpggyvaairaaqlglktaciekyigkegkvalggtclnvgcipskall
    dssykyheakeafkvhgieakgvtidvpamvarkanivknltggiatlfkangvtsfegh
    gkllankqvevtgldgktqvleaenviiasgsrpveippaplsddiivdstgalefqavp
    kklgvigagviglelgsvwarlgaevtvlealdkflpaadeqiakealkvltkqglnirl
    garvtasevkkkqvtvtftdangeqketfdklivavgrrpvttdllaadsgvtldergfi
    yvddhcktsvpgvfaigdvvrgamlahkaseegvmvaeriaghkaqmnydlipsviythp
    eiawvgkteqtlkaegvevnvgtfpfaasgramaandttglvkviadaktdrvlgvhvig
    psaaelvqqgaigmefgtsaedlgmmvfshptlsealheaalavnghaihia