PDB entry 1lpc

View 1lpc on RCSB PDB site
Description: high resolution structure of recombinant dianthin antiviral protein-potent anti-hiv agent (complex with cyclic amp)
Class: antiviral protein
Keywords: dianthin antiviral protein, ribosome inactivating protein, anti-hiv agent, hiv-1 integrase inhibitor, polynucleotide:adenosine glycosidase
Deposited on 2002-05-07, released 2004-05-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dianthin 30
  Species: Dianthus caryophyllus [TaxId:3570]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24476 (0-253)
  Domains in SCOPe 2.05: d1lpca_
• Heterogens: CMP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lpcA (A:)
  ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr
  gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
  yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
  fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
  dlqmgllkylgrpk