PDB entry 1lpb

View 1lpb on RCSB PDB site
Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate
Deposited on 1994-08-19, released 1994-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 2.46 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpbA (A:)
    giiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyykcpcer
    gltcegdkslvgsitntnfgichnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpbB (B:)
    kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
    sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
    pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
    nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
    psggcpqmghyadrypgktndvgqkfyldtgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlqmvkfiwynnvinptlprvgaski
    ivetnvgkqfnfcspetvreevlltltpc