PDB entry 1lpb

View 1lpb on RCSB PDB site
Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase)
Deposited on 1994-08-19, released 1994-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colipase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lpba1, d1lpba2
  • Chain 'B':
    Compound: Lipase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lpbb1, d1lpbb2
  • Heterogens: BOG, CA, MUP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lpbA (A:)
    vpdprgiiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyyk
    cpcergltcegdkslvgsitntnfgichnvgrsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lpbA (A:)
    giiinldegelclnsaqcksnccqhdtilslsrcalkarensecsaftlygvyykcpcer
    gltcegdkslvgsitntnfgichnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpbB (B:)
    kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
    sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
    pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
    nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
    psggcpqmghyadrypgktndvgqkfyldtgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlqmvkfiwynnvinptlprvgaski
    ivetnvgkqfnfcspetvreevlltltpc