PDB entry 1lpa

View 1lpa on RCSB PDB site
Description: interfacial activation of the lipase-procolipase complex by mixed micelles revealed by x-ray crystallography
Deposited on 1994-08-19, released 1994-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 3.04 Å
R-factor: 0.186
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpaA (A:)
    giiinldegelclnsaqcksnccqhdtilsllrcalkarensecsaftlygvyykcpcer
    gltcegdkslvgsitntnfgichnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpaB (B:)
    kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
    sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
    pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
    nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
    psggcpqmghyadrypgktndvgqkfyldtgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlqmvkfiwynnvinptlprvgaski
    ivetnvgkqfnfcspetvreevlltltpc