PDB entry 1lpa

View 1lpa on RCSB PDB site
Description: interfacial activation of the lipase-procolipase complex by mixed micelles revealed by x-ray crystallography
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase)
Deposited on 1994-08-19, released 1994-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colipase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lpaa1, d1lpaa2
  • Chain 'B':
    Compound: Lipase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lpab1, d1lpab2
  • Heterogens: BNG, CA, PLC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lpaA (A:)
    vpdprgiiinldegelclnsaqcksnccqhdtilsllrcalkarensecsaftlygvyyk
    cpcergltcegdkslvgsitntnfgichnvgrsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lpaA (A:)
    giiinldegelclnsaqcksnccqhdtilsllrcalkarensecsaftlygvyykcpcer
    gltcegdkslvgsitntnfgichnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lpaB (B:)
    kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
    sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
    pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
    nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
    psggcpqmghyadrypgktndvgqkfyldtgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlqmvkfiwynnvinptlprvgaski
    ivetnvgkqfnfcspetvreevlltltpc