PDB entry 1lp8

View 1lp8 on RCSB PDB site
Description: high resolution structure of recombinant dianthin antiviral protein-potent anti-hiv agent
Class: antiviral protein
Keywords: dianthin antiviral protein, ribosome inactivating protein, anti-hiv agent, hiv-1 integrase inhibitor, polynucleotide:adenosine glycosidase
Deposited on 2002-05-07, released 2004-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.18
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dianthin 30
    Species: Dianthus caryophyllus [TaxId:3570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lp8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lp8A (A:)
    ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvevigapsttdkflrlnfqgpr
    gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
    yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
    fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
    dlqmgllkylgrpk