PDB entry 1lp6

View 1lp6 on RCSB PDB site
Description: Crystal structure of orotidine monophosphate decarboxylase complexed with CMP
Class: lyase
Keywords: TIM barrel
Deposited on 2002-05-07, released 2002-08-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine monophosphate decarboxylase
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (100)
    Domains in SCOP 1.75: d1lp6a_
  • Chain 'B':
    Compound: orotidine monophosphate decarboxylase
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-227)
      • see remark 999 (100)
      • conflict (226)
      • insertion (228)
    Domains in SCOP 1.75: d1lp6b_
  • Heterogens: C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lp6A (A:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lp6A (A:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgetlrfad
    aiivgrsiyladnpaaaaagiies
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lp6B (B:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lp6B (B:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggdpgetlrf
    adaiivgrsiyladnpaaaaagiiesikdllipe