PDB entry 1lp3

View 1lp3 on RCSB PDB site
Description: The Atomic Structure of Adeno-Associated Virus (AAV-2), a Vector for Human Gene Therapy
Class: Virus
Keywords: capsid, single-stranded, DNA, beta-barrel, parvovirus, satellite, human, Icosahedral virus, Virus
Deposited on 2002-05-07, released 2002-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.338
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AAV-2 capsid protein
    Species: Adeno-associated virus - 2 [TaxId:10804]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lp3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lp3A (A:)
    gadgvgnssgnwhcdstwmgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevtqndgtttiannl
    tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylsrtntpsgttt
    qsrlqfsqagasdirdqsrnwlpgpcyrqqrvsktsadnnnseyswtgatkyhlngrdsl
    vnpgpamashkddeekffpqsgvlifgkqgsektnvdiekvmitdeeeirttnpvateqy
    gsvstnlqrgnrqaatadvntqgvlpgmvwqdrdvylqgpiwakiphtdghfhpsplmgg
    fglkhpppqilikntpvpanpsttfsaakfasfitqystgqvsveiewelqkenskrwnp
    eiqytsnynksvnvdftvdtngvyseprpigtryltrnl