PDB entry 1loy

View 1loy on RCSB PDB site
Description: X-ray structure of the H40A/E58A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate
Class: hydrolase
Keywords: RNase, catalytic dyad, nucleophile activation, ab initio calculations, HYDROLASE
Deposited on 2002-05-07, released 2002-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.189
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • see remark 999 (24)
      • engineered (39)
      • engineered (57)
    Domains in SCOPe 2.06: d1loya_
  • Heterogens: CA, 3GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1loyA (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsypakynnyegfdfsvsspyyawp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect