PDB entry 1lox

View 1lox on RCSB PDB site
Description: rabbit reticulocyte 15-lipoxygenase
Deposited on 1997-10-06, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-12-02, with a file datestamp of 1998-12-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1lox_ (-)
    gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
    fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvgtgcttvgdp
    qglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkkidfeaslaw
    glaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyqflnganpml
    lrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaapl
    vmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnsh
    llrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimst
    gggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimg
    lyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqh
    ssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlkqsslqmsivwqlgrdq
    pimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeylrpsivensv
    ai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lox_ (-)
    gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
    fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvgtgcttvgdp
    qglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkkidfeasnsl
    nilapwktlddfnrifgrsklarrvrdswqedslfgyqflnganpmllrrsvqlparlvf
    ppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaaplvmlklqpdgklmp
    mviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnshllrghlmaevftv
    atmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimstgggghvqllqqag
    afltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimglyyktdeavrddl
    elqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqhssihlgqldwftw
    vpnapctmrlpppttkdatletvmatlpnlkqsslqmsivwqlgqpimvplgqhqeeyfs
    gpepravlekfreelaimdkeievrnekldipyeylrpsivensvai