PDB entry 1lox

View 1lox on RCSB PDB site
Description: rabbit reticulocyte 15-lipoxygenase
Class: oxidoreductase
Keywords: oxidoreductase, 15lo_depot2
Deposited on 1997-10-06, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 15-lipoxygenase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12530 (0-661)
      • conflict (583)
    Domains in SCOPe 2.08: d1loxa1, d1loxa2
  • Heterogens: FE2, RS7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1loxA (A:)
    gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
    fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvgtgcttvgdp
    qglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkkidfeaslaw
    glaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyqflnganpml
    lrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaapl
    vmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnsh
    llrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimst
    gggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimg
    lyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqh
    ssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlkqsslqmsivwqlgrdq
    pimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeylrpsivensv
    ai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1loxA (A:)
    gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
    fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvgtgcttvgdp
    qglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkkidfelknsl
    nilapwktlddfnrifwrsklarrvrdswqedslfgyqflnganpmllrrsvqlparlvf
    ppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaaplvmlklqpdgklmp
    mviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnshllrghlmaevftv
    atmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimstgggghvqllqqag
    afltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimglyyktdeavrddl
    elqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqhssihlgqldwftw
    vpnapctmrlpppttkdatletvmatlpnlkqsslqmsivwqlgrdimvplgqhqeeyfs
    gpepravlekfreelaimdkeievrnekldipyeylrpsivensvai