PDB entry 1los

View 1los on RCSB PDB site
Description: crystal structure of orotidine monophosphate decarboxylase mutant deltaR203A complexed with 6-azaUMP
Class: lyase
Keywords: TIM barrel, LYASE
Deposited on 2002-05-06, released 2002-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine monophosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (100)
      • engineered (198)
    Domains in SCOPe 2.06: d1losa_
  • Chain 'B':
    Compound: orotidine monophosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (100)
      • engineered (198)
    Domains in SCOPe 2.06: d1losb_
  • Chain 'C':
    Compound: orotidine monophosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (100)
      • engineered (198)
    Domains in SCOPe 2.06: d1losc_
  • Chain 'D':
    Compound: orotidine monophosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (100)
      • engineered (198)
    Domains in SCOPe 2.06: d1losd_
  • Heterogens: UP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1losA (A:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1losA (A:)
    srrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkr
    fgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfl
    ltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgv
    gdpgetlrfadaiivgasiyladnpaaaaagiiesi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1losB (B:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1losB (B:)
    mnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadf
    kvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpga
    emfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgdpgetlrf
    adaiivgasiyladnpaaaaagiies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1losC (C:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1losC (C:)
    nrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfk
    vadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgae
    mfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgdpgetlrfa
    daiivgasiyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1losD (D:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1losD (D:)
    rrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrf
    gcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfll
    temshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvg
    dpgetlrfadaiivgasiyladnpaaaaagiies