PDB entry 1los

View 1los on RCSB PDB site
Description: crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump
Deposited on 2002-05-06, released 2002-08-07
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1losa_
  • Chain 'B':
    Domains in SCOP 1.61: d1losb_
  • Chain 'C':
    Domains in SCOP 1.61: d1losc_
  • Chain 'D':
    Domains in SCOP 1.61: d1losd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1losA (A:)
    srrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkr
    fgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfl
    ltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgv
    gdpgetlrfadaiivgasiyladnpaaaaagiiesi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1losB (B:)
    mnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadf
    kvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpga
    emfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgdpgetlrf
    adaiivgasiyladnpaaaaagiies
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1losC (C:)
    nrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfk
    vadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgae
    mfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgdpgetlrfa
    daiivgasiyl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1losD (D:)
    rrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrf
    gcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfll
    temshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvg
    dpgetlrfadaiivgasiyladnpaaaaagiies