PDB entry 1loq

View 1loq on RCSB PDB site
Description: Crystal structure of orotidine monophosphate decarboxylase complexed with product UMP
Class: Lyase
Keywords: TIM barrel, Lyase
Deposited on 2002-05-06, released 2002-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.173
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Archaea [TaxId:2157]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • modified residue (64)
      • see remark 999 (100)
    Domains in SCOPe 2.06: d1loqa_
  • Heterogens: U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1loqA (A:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1loqA (A:)
    rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkv
    adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
    fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
    rfadaiivgrsiyladnpaaaaagiiesi