PDB entry 1lop

View 1lop on RCSB PDB site
Description: cyclophilin a complexed with succinyl-ala-pro-ala-p-nitroanilide
Class: isomerase/isomerase inhibitor
Keywords: ROTAMASE, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 1996-06-17, released 1996-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23869 (0-163)
      • conflict (131)
    Domains in SCOPe 2.06: d1lopa_
  • Chain 'B':
    Compound: succinyl-ala-pro-ala-p-nitroanilide
    Database cross-references and differences (RAF-indexed):
    • PDB 1LOP (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lopA (A:)
    mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
    qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
    cvfaevvdgmdevdkikgvatgrsgmhqdvpkedviiesvtvse
    

  • Chain 'B':
    No sequence available.