PDB entry 1lop

View 1lop on RCSB PDB site
Description: cyclophilin a complexed with succinyl-ala-pro-ala-p-nitroanilide
Deposited on 1996-06-17, released 1996-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1lopa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lopA (A:)
    mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
    qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
    cvfaevvdgmdevdkikgvatgrsgmhqdvpkedviiesvtvse