PDB entry 1lol

View 1lol on RCSB PDB site
Description: Crystal structure of orotidine monophosphate decarboxylase complex with XMP
Class: lyase
Keywords: TIM barrel, LYASE
Deposited on 2002-05-06, released 2002-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (100)
    Domains in SCOPe 2.06: d1lola_
  • Chain 'B':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-228)
      • see remark 999 (100)
      • conflict (226)
      • insertion (228)
    Domains in SCOPe 2.06: d1lolb_
  • Heterogens: BU2, XMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lolA (A:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lolA (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggetlrfada
    iivgrsiyladnpaaaaagiiesi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lolB (B:)
    lrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lolB (B:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggdpgetlrf
    adaiivgrsiyladnpaaaaagiiesikdllipe