PDB entry 1loj

View 1loj on RCSB PDB site
Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)
Class: RNA BINDING PROTEIN, transcription
Keywords: beta barrel, OB-fold, heptameric toroid, tetradecamer, RNA BINDING PROTEIN, transcription
Deposited on 2002-05-06, released 2003-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-83)
    Domains in SCOPe 2.06: d1loja1, d1loja2
  • Chain 'B':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-85)
    Domains in SCOPe 2.06: d1lojb1, d1lojb2
  • Chain 'C':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-86)
    Domains in SCOPe 2.06: d1lojc1, d1lojc2
  • Chain 'D':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-82)
    Domains in SCOPe 2.06: d1lojd1, d1lojd2
  • Chain 'E':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-83)
    Domains in SCOPe 2.06: d1loje1, d1loje2
  • Chain 'F':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-83)
    Domains in SCOPe 2.06: d1lojf1, d1lojf2
  • Chain 'G':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-83)
    Domains in SCOPe 2.06: d1lojg1, d1lojg2
  • Chain 'H':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-84)
    Domains in SCOPe 2.06: d1lojh1, d1lojh2
  • Chain 'I':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-82)
    Domains in SCOPe 2.06: d1loji1, d1loji2
  • Chain 'J':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-85)
    Domains in SCOPe 2.06: d1lojj1, d1lojj2
  • Chain 'K':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80)
    Domains in SCOPe 2.06: d1lojk1, d1lojk2
  • Chain 'L':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-82)
    Domains in SCOPe 2.06: d1lojl1, d1lojl2
  • Chain 'M':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-82)
    Domains in SCOPe 2.06: d1lojm1, d1lojm2
  • Chain 'N':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: Mth649
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26745 (Start-80)
      • cloning artifact (80-82)
    Domains in SCOPe 2.06: d1lojn1, d1lojn2
  • Heterogens: URI, U, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lojA (A:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojA (A:)
    vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
    vlirgdnivyisrgkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lojB (B:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojB (B:)
    vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
    irgdnivyisrgklaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lojC (C:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojC (C:)
    vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
    irgdnivyisrgklaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lojD (D:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojD (D:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lojE (E:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojE (E:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lojF (F:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojF (F:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lojG (G:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojG (G:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lojH (H:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojH (H:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgkla
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1lojI (I:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojI (I:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1lojJ (J:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojJ (J:)
    vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
    irgdnivyisrgklaa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1lojK (K:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojK (K:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1lojL (L:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojL (L:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1lojM (M:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojM (M:)
    vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
    irgdnivyisrgk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1lojN (N:)
    midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
    evtrrlgtvlirgdnivyisrgklaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lojN (N:)
    nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
    lirgdnivyisrgk