SCOP 1.75: Structural Classification of Proteins

PDB entry 1loj

View 1loj on RCSB PDB site
Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)
Class: RNA BINDING PROTEIN, transcription
Keywords: beta barrel, OB-fold, heptameric toroid, tetradecamer
Deposited on 2002-05-06, released 2003-03-25
The last revision prior to the SCOP 1.75 freeze date was dated 2003-03-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-83)
Domains in SCOP 1.75: d1loja_
Chain 'B':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-85)
Domains in SCOP 1.75: d1lojb_
Chain 'C':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-86)
Domains in SCOP 1.75: d1lojc_
Chain 'D':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-82)
Domains in SCOP 1.75: d1lojd_
Chain 'E':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-83)
Domains in SCOP 1.75: d1loje_
Chain 'F':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-83)
Domains in SCOP 1.75: d1lojf_
Chain 'G':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-83)
Domains in SCOP 1.75: d1lojg_
Chain 'H':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-84)
Domains in SCOP 1.75: d1lojh_
Chain 'I':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-82)
Domains in SCOP 1.75: d1loji_
Chain 'J':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-85)
Domains in SCOP 1.75: d1lojj_
Chain 'K':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80)
Domains in SCOP 1.75: d1lojk_
Chain 'L':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-82)
Domains in SCOP 1.75: d1lojl_
Chain 'M':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-82)
Domains in SCOP 1.75: d1lojm_
Chain 'N':
Compound: small nuclear ribonucleoprotein homolog (Sm-like)
Species: Methanobacterium thermoautotrophicum
Gene: Mth649
Database cross-references and differences (RAF-indexed):
- Uniprot O26745 (Start-80)
  - cloning artifact (80-82)
Domains in SCOP 1.75: d1lojn_
Heterogens: URI, U, MPD, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1lojA (A:)
midvssqrvnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledg
evtrrlgtvlirgdnivyisrgklaaa