PDB entry 1log

View 1log on RCSB PDB site
Description: x-ray structure of a (alpha-man(1-3)beta-man(1-4)glcnac)-lectin complex at 2.1 angstroms resolution
Deposited on 1994-01-27, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1log.1
  • Chain 'B':
    Domains in SCOP 1.55: d1log.1
  • Chain 'C':
    Domains in SCOP 1.55: d1log.2
  • Chain 'D':
    Domains in SCOP 1.55: d1log.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1logA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1logB (B:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1logC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1logD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtss