PDB entry 1lof

View 1lof on RCSB PDB site
Description: x-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Class: lectin
Keywords: lectin
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: legume isolectin I (alpha chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-180)
      • conflict (152)
    Domains in SCOP 1.73: d1lof.1
  • Chain 'B':
    Compound: legume isolectin I (beta chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12306 (0-End)
      • conflict (40)
    Domains in SCOP 1.73: d1lof.1
  • Chain 'C':
    Compound: legume isolectin I (alpha chain)
    Species: Lathyrus ochrus
    Domains in SCOP 1.73: d1lof.2
  • Chain 'D':
    Compound: legume isolectin I (beta chain)
    Species: Lathyrus ochrus
    Domains in SCOP 1.73: d1lof.2
  • Heterogens: GAL, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lofA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lofB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lofB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lofC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lofC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lofD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtssn