PDB entry 1lof

View 1lof on RCSB PDB site
Description: x-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.67 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1lof.1
  • Chain 'B':
    Domains in SCOP 1.67: d1lof.1
  • Chain 'C':
    Domains in SCOP 1.67: d1lof.2
  • Chain 'D':
    Domains in SCOP 1.67: d1lof.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lofA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lofB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lofB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lofC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lofC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswklqngkeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lofD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtssn