PDB entry 1loe

View 1loe on RCSB PDB site
Description: x-ray crystal structure determination and refinement at 1.9 angstroms resolution of isolectin i from the seeds of lathyrus ochrus
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.67 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1loe.1
  • Chain 'B':
    Domains in SCOP 1.67: d1loe.1
  • Chain 'C':
    Domains in SCOP 1.67: d1loe.2
  • Chain 'D':
    Domains in SCOP 1.67: d1loe.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1loeA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1loeA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1loeB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1loeB (B:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loeC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1loeD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1loeD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela