PDB entry 1loc

View 1loc on RCSB PDB site
Description: interaction of a legume lectin with two components of the bacterial cell wall
Class: lectin
Keywords: lectin
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.73 freeze date was dated 1994-04-30, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: muramyl-dipeptide d-ala-d-igln
  • Chain '2':
    Compound: muramyl-dipeptide d-ala-d-igln
  • Chain '3':
    Compound: muramyl-dipeptide d-ala-d-igln
  • Chain '4':
    Compound: muramyl-dipeptide d-ala-d-igln
  • Chain 'A':
    Compound: legume isolectin I (alpha chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-End)
      • conflict (152)
    Domains in SCOP 1.73: d1loc.1
  • Chain 'B':
    Compound: legume isolectin I (beta chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12306 (0-End)
      • conflict (40)
    Domains in SCOP 1.73: d1loc.1
  • Chain 'C':
    Compound: legume isolectin I (alpha chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-End)
      • conflict (152)
    Domains in SCOP 1.73: d1loc.2
  • Chain 'D':
    Compound: legume isolectin I (beta chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12306
      • conflict (40)
    Domains in SCOP 1.73: d1loc.2
  • Chain 'E':
    Compound: legume isolectin I (alpha chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-End)
      • conflict (152)
    Domains in SCOP 1.73: d1loc.3
  • Chain 'F':
    Compound: legume isolectin I (beta chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12306 (0-End)
      • conflict (40)
    Domains in SCOP 1.73: d1loc.3
  • Chain 'G':
    Compound: legume isolectin I (alpha chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-End)
      • conflict (152)
    Domains in SCOP 1.73: d1loc.4
  • Chain 'H':
    Compound: legume isolectin I (beta chain)
    Species: Lathyrus ochrus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12306
      • conflict (40)
    Domains in SCOP 1.73: d1loc.4
  • Heterogens: CA, MN, NH2, HOH

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1locA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1locB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1locC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1locD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locD (D:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1locE (E:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locE (E:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1locF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1locG (G:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locG (G:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1locH (H:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1locH (H:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag