PDB entry 1loc

View 1loc on RCSB PDB site
Description: interaction of a legume lectin with two components of the bacterial cell wall
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1loc.1
  • Chain 'B':
    Domains in SCOP 1.55: d1loc.1
  • Chain 'C':
    Domains in SCOP 1.55: d1loc.2
  • Chain 'D':
    Domains in SCOP 1.55: d1loc.2
  • Chain 'E':
    Domains in SCOP 1.55: d1loc.3
  • Chain 'F':
    Domains in SCOP 1.55: d1loc.3
  • Chain 'G':
    Domains in SCOP 1.55: d1loc.4
  • Chain 'H':
    Domains in SCOP 1.55: d1loc.4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locD (D:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locE (E:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locG (G:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1locH (H:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag