PDB entry 1lob

View 1lob on RCSB PDB site
Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide-binding site
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.67 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1lob.1
  • Chain 'B':
    Domains in SCOP 1.67: d1lob.1
  • Chain 'C':
    Domains in SCOP 1.67: d1lob.2
  • Chain 'D':
    Domains in SCOP 1.67: d1lob.2
  • Chain 'E':
    Domains in SCOP 1.67: d1lob.3
  • Chain 'F':
    Domains in SCOP 1.67: d1lob.3
  • Chain 'G':
    Domains in SCOP 1.67: d1lob.4
  • Chain 'H':
    Domains in SCOP 1.67: d1lob.4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lobA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lobB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lobC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lobD (D:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobD (D:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lobE (E:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobE (E:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lobF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lobG (G:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobG (G:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lobH (H:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselagtsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lobH (H:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag