PDB entry 1loa

View 1loa on RCSB PDB site
Description: three-dimensional structures of complexes of lathyrus ochrus isolectin i with glucose and mannose: fine specificity of the monosaccharide-binding site
Deposited on 1993-01-27, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1loa.1
  • Chain 'B':
    Domains in SCOP 1.55: d1loa.1
  • Chain 'C':
    Domains in SCOP 1.55: d1loa.2
  • Chain 'D':
    Domains in SCOP 1.55: d1loa.2
  • Chain 'E':
    Domains in SCOP 1.55: d1loa.3
  • Chain 'F':
    Domains in SCOP 1.55: d1loa.3
  • Chain 'G':
    Domains in SCOP 1.55: d1loa.4
  • Chain 'H':
    Domains in SCOP 1.55: d1loa.4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaA (A:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaC (C:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaD (D:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaE (E:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaF (F:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfhsela
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaG (G:)
    tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1loaH (H:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfhselag