PDB entry 1lo9

View 1lo9 on RCSB PDB site
Description: x-ray crystal structure of 4-hydroxybenzoyl coa thioesterase mutant d17n complexed with 4-hydroxybenzoyl coa
Deposited on 2002-05-06, released 2002-05-13
The last revision prior to the SCOP 1.67 freeze date was dated 2002-05-13, with a file datestamp of 2002-05-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.148
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1lo9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lo9A (A:)
    marsitmqqriefgdcnpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtp
    ivscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfa
    mndgerlraievpadyielcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lo9A (A:)
    arsitmqqriefgdcnpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
    vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
    ndgerlraievpadyielcs