PDB entry 1lo8

View 1lo8 on RCSB PDB site
Description: x-ray crystal structure of 4-hydroxybenzoyl coa thioesterase complexed with 4-hydroxybenzyl coa
Deposited on 2002-05-06, released 2002-05-17
The last revision prior to the SCOP 1.67 freeze date was dated 2002-05-17, with a file datestamp of 2002-05-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1lo8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lo8A (A:)
    marsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtp
    ivscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfa
    mndgerlraievpadyielcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lo8A (A:)
    arsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
    vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
    ndgerlraievpadyielcs