PDB entry 1lo8

View 1lo8 on RCSB PDB site
Description: X-ray crystal structure of 4-hydroxybenzoyl CoA thioesterase complexed with 4-hydroxybenzyl CoA
Class: hydrolase
Keywords: Thioesterase, hot dog fold, catalytic mechanism, HYDROLASE
Deposited on 2002-05-06, released 2002-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Pseudomonas sp. CBS3 [TaxId:72586]
    Gene: 4HBT_PSESP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56653 (Start-140)
      • conflict (23)
    Domains in SCOPe 2.08: d1lo8a_
  • Heterogens: 4CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lo8A (A:)
    marsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtp
    ivscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfa
    mndgerlraievpadyielcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lo8A (A:)
    arsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
    vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
    ndgerlraievpadyielcs