PDB entry 1lo4

View 1lo4 on RCSB PDB site
Description: Retro-Diels-Alderase Catalytic antibody 9D9
Class: immune system
Keywords: Fab, catalytic antibody, retro-Deils-Alderase
Deposited on 2002-05-06, released 2002-07-03
The last revision prior to the SCOP 1.73 freeze date was dated 2002-07-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig gamma 2a heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1lo4h1, d1lo4h2
  • Chain 'L':
    Compound: If kappa light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lo4l1, d1lo4l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo4H (H:)
    elklvetggdlvkpggsltlsceasgftlrtygmswvrqtpqmrlewvasisyggllyfs
    dsvkgrftisrdivrniltlqmsrlrsedtaiyycargtsfvryfdvwgagttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkivpraa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo4L (L:)
    dvlltqtplslpvslgdqasiscrssqtivhtngntyfewylqkpgqsphlliykvsnrl
    sgvpdrfsgsgsgtdftlkisrveaedlglyycfqgshspwtfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn