PDB entry 1lo4

View 1lo4 on RCSB PDB site
Description: retro-diels-alderase catalytic antibody 9d9
Deposited on 2002-05-06, released 2002-07-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo4H (H:)
    elklvetggdlvkpggsltlsceasgftlrtygmswvrqtpqmrlewvasisyggllyfs
    dsvkgrftisrdivrniltlqmsrlrsedtaiyycargtsfvryfdvwgagttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkivpraa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo4L (L:)
    dvlltqtplslpvslgdqasiscrssqtivhtngntyfewylqkpgqsphlliykvsnrl
    sgvpdrfsgsgsgtdftlkisrveaedlglyycfqgshspwtfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn