PDB entry 1lo3

View 1lo3 on RCSB PDB site
Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue
Class: immune system
Keywords: Fab, catalytic antibody, product complex, IMMUNE SYSTEM
Deposited on 2002-05-06, released 2002-07-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig gamma 2a heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1LO3 (0-219)
    Domains in SCOPe 2.03: d1lo3h1, d1lo3h2
  • Chain 'L':
    Compound: If kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lo3l1, d1lo3l2
  • Chain 'X':
    Compound: If kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lo3x1, d1lo3x2
  • Chain 'Y':
    Compound: Ig gamma 2a heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1LO3 (0-219)
    Domains in SCOPe 2.03: d1lo3y1, d1lo3y2
  • Heterogens: AN1, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3H (H:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3L (L:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3X (X:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3Y (Y:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp