PDB entry 1lo3

View 1lo3 on RCSB PDB site
Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue
Deposited on 2002-05-06, released 2002-07-03
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3H (H:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3L (L:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3X (X:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo3Y (Y:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp