PDB entry 1lo2

View 1lo2 on RCSB PDB site
Description: Retro-Diels-Alderase Catalytic Antibody
Class: immune system
Keywords: catalytic antibody, Fab, retro-Diels-Alderase
Deposited on 2002-05-06, released 2002-06-26
The last revision prior to the SCOP 1.75 freeze date was dated 2002-07-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig gamma 2a heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1lo2h1, d1lo2h2
  • Chain 'L':
    Compound: If kappa light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lo2l1, d1lo2l2
  • Chain 'X':
    Compound: If kappa light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lo2x1, d1lo2x2
  • Chain 'Y':
    Compound: Ig gamma 2a heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1lo2y1, d1lo2y2
  • Heterogens: OX1, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo2H (H:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo2L (L:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo2X (X:)
    dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lo2Y (Y:)
    evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
    dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp