PDB entry 1lo1

View 1lo1 on RCSB PDB site
Description: estrogen related receptor 2 dna binding domain in complex with dna
Deposited on 2002-05-05, released 2003-04-22
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1lo1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lo1A (A:)
    aipkrlclvcgdiasgyhygvasceackaffkrtiqgnieyscpatneceitkrrrkscq
    acrfmkalkvgmlkegvrldrvrggrqkykrrldsens
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lo1A (A:)
    aipkrlclvcgdiasgyhygvasceackaffkrtiqgnieyscpatneceitkrrrkscq
    acrfmkalkvgmlkegvrldrvrggrqkyk