PDB entry 1lo1

View 1lo1 on RCSB PDB site
Description: estrogen related receptor 2 DNA binding domain in complex with DNA
Class: hormone/growth factor receptor/DNA
Keywords: Estrogen Related Receptor 2, DNA Binding Domain, hERR2, Hormone Nuclear Receptor, HORMONE/GROWTH FACTOR RECEPTOR/DNA COMPLEX
Deposited on 2002-05-05, released 2003-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid hormone receptor ERR2
    Species: Homo sapiens [TaxId:9606]
    Gene: hERR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95718 (0-End)
      • engineered (66)
    Domains in SCOPe 2.08: d1lo1a_
  • Chain 'B':
    Compound: 5'-d(*gp*cp*tp*cp*ap*ap*gp*gp*tp*cp*ap*cp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*gp*tp*gp*ap*cp*cp*tp*tp*gp*ap*gp*c)-3'
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lo1A (A:)
    aipkrlclvcgdiasgyhygvasceackaffkrtiqgnieyscpatneceitkrrrkscq
    acrfmkalkvgmlkegvrldrvrggrqkykrrldsens
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lo1A (A:)
    aipkrlclvcgdiasgyhygvasceackaffkrtiqgnieyscpatneceitkrrrkscq
    acrfmkalkvgmlkegvrldrvrggrqkyk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.