PDB entry 1lnz

View 1lnz on RCSB PDB site
Description: Structure of the Obg GTP-binding protein
Class: cell cycle
Keywords: GTPase, Obg, stringent factor, stress response, sporulation, large G-protein, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, CELL CYCLE
Deposited on 2002-05-04, released 2002-09-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SPO0B-associated GTP-binding protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20964 (0-341)
      • cloning artifact (0)
      • cloning artifact (18)
      • cloning artifact (55)
      • cloning artifact (72)
      • cloning artifact (84)
      • cloning artifact (198)
      • cloning artifact (209)
      • cloning artifact (245)
      • cloning artifact (283)
      • cloning artifact (285)
    Domains in SCOPe 2.01: d1lnza1, d1lnza2
  • Chain 'B':
    Compound: SPO0B-associated GTP-binding protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20964 (0-End)
      • cloning artifact (0)
      • cloning artifact (18)
      • cloning artifact (55)
      • cloning artifact (72)
      • cloning artifact (84)
      • cloning artifact (198)
      • cloning artifact (209)
      • cloning artifact (245)
      • cloning artifact (283)
      • cloning artifact (285)
    Domains in SCOPe 2.01: d1lnzb1, d1lnzb2
  • Heterogens: MG, G4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lnzA (A:)
    mfvdqvkvyvkggdggngmvafrrekyvpkggpaggdggkggdvvfevdeglrtlmdfry
    kkhfkairgehgmsknqhgrnaddmvikvppgtvvtdddtkqviadltehgqraviargg
    rggrgnsrfatpanpapqlsengepgkeryivlelkvladvglvgfpsvgkstllsvvss
    akpkiadyhfttlvpnlgmvetddgrsfvmadlpgliegahqgvglghqflrhiertrvi
    vhvidmsglegrdpyddyltinqelseynlrlterpqiivankmdmpeaaenleafkekl
    tddypvfpisavtreglrellfevanqlentpefplydeeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lnzB (B:)
    mfvdqvkvyvkggdggngmvafrrekyvpkggpaggdggkggdvvfevdeglrtlmdfry
    kkhfkairgehgmsknqhgrnaddmvikvppgtvvtdddtkqviadltehgqraviargg
    rggrgnsrfatpanpapqlsengepgkeryivlelkvladvglvgfpsvgkstllsvvss
    akpkiadyhfttlvpnlgmvetddgrsfvmadlpgliegahqgvglghqflrhiertrvi
    vhvidmsglegrdpyddyltinqelseynlrlterpqiivankmdmpeaaenleafkekl
    tddypvfpisavtreglrellfevanqlentpefplydeeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnzB (B:)
    mfvdqvkvyvkggdggngmvafrrekyvpkggpaggdggkggdvvfevdeglrtlmdfry
    kkhfkairgehgmsknqhgrnaddmvikvppgtvvtdddtkqviadltehgqraviargg
    rggrgnsrfatpanpapqlsengepgkeryivlelkvladvglvgfpsvgkstllsvvss
    akpkipnlgmvetddgrsfvmadlpglieghqflrhiertrvivhvidmsglegrdpydd
    yltinqelseynlrlterpqiivankmdmpeaaenleafkekltddypvfpisavtregl
    rellfevanqlentpefply