PDB entry 1lnx

View 1lnx on RCSB PDB site
Description: Crystal structure of the P.aerophilum SmAP1 heptamer in a new crystal form (C2221)
Class: RNA BINDING PROTEIN, transcription
Keywords: beta barrel-like structure (OB fold); homoheptameric, RNA BINDING PROTEIN, transcription
Deposited on 2002-05-04, released 2003-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.182
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZYG5 (Start-79)
      • cloning artifact (80)
    Domains in SCOPe 2.07: d1lnxa1, d1lnxa2
  • Chain 'B':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lnxb_
  • Chain 'C':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lnxc_
  • Chain 'D':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lnxd_
  • Chain 'E':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lnxe_
  • Chain 'F':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZYG5 (Start-79)
      • cloning artifact (80)
    Domains in SCOPe 2.07: d1lnxf1, d1lnxf2
  • Chain 'G':
    Compound: small nuclear ribonucleoprotein homolog (Sm-like)
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: SmAP1, GPA2549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lnxg_
  • Heterogens: URI, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lnxA (A:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxA (A:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lnxB (B:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxB (B:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lnxC (C:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxC (C:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lnxD (D:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxD (D:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lnxE (E:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxE (E:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lnxF (F:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxF (F:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvpg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lnxG (G:)
    masdiskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnv
    ykrgtmvvrgenvlfispvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnxG (G:)
    cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
    vrgenvlfispvp