PDB entry 1lni

View 1lni on RCSB PDB site
Description: crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic resolution (1.0 a)
Class: hydrolase
Keywords: Ribonuclease Sa, HYDROLASE
Deposited on 2002-05-03, released 2002-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 2002-07-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.116
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens
    Gene: U39467
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lnia_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens
    Gene: U39467
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lnib_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lniA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lniB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc