PDB entry 1lnh

View 1lnh on RCSB PDB site
Description: lipoxygenase-3(soybean) non-heme fe(II) metalloprotein
Class: oxidoreductase
Keywords: oxidoreductase, metalloprotein, fe(II) complex
Deposited on 1996-03-29, released 1997-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.174
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lnha1, d1lnha2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lnhA (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnhA (A:)
    ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
    legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
    hfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlrgdgtgerkeweri
    ydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpnsesrsndvylprd
    eafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevhglysggiklptdi
    iskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefaremlagvnpnlirclk
    dfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflldhhdpimpylrrin
    atstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflpadegvessiwlla
    kayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllhphyrdtmningla
    rlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrgmaiedpscphgir
    lviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacwkelvevghgdkkn
    epwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrptlsrrfmpekgsae
    yeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdnpnwtsdtraleaf
    krfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltfrgipnsisi