PDB entry 1lng

View 1lng on RCSB PDB site
Description: Crystal Structure of the SRP19-7S.S SRP RNA Complex of M. jannaschii
Class: signaling protein/RNA
Keywords: Protein-RNA complex, SIGNALING PROTEIN/RNA COMPLEX
Deposited on 2002-05-03, released 2002-06-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 19 kda protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lnga_
  • Chain 'B':
    Compound: 7s.s srp RNA
    Species: Methanocaldococcus jannaschii [TaxId:2190]
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lngA (A:)
    miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
    cgcvevdykgnklqllkeickiikgkn
    

  • Chain 'B':
    No sequence available.