PDB entry 1lng

View 1lng on RCSB PDB site
Description: crystal structure of the srp19-7s.s srp rna complex of m. jannaschii
Deposited on 2002-05-03, released 2002-06-07
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lnga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lngA (A:)
    miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
    cgcvevdykgnklqllkeickiikgkn