PDB entry 1ln8

View 1ln8 on RCSB PDB site
Description: Crystal Structure of a New Isoform of Phospholipase A2 from Naja naja sagittifera at 1.6 A Resolution
Class: hydrolase
Keywords: phospholipase A2, isoform, naja naja sagittifera
Deposited on 2002-05-03, released 2003-05-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-05-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Naja sagittifera
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60045 (0-118)
  Domains in SCOP 1.73: d1ln8a_
• Heterogens: CA, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ln8A (A:)
  nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
  rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn