PDB entry 1lms

View 1lms on RCSB PDB site
Description: Structural model for an alkaline form of ferricytochrome c
Class: electron transport
Keywords: alkaline transition; cytochrome c; NMR structure, ELECTRON TRANSPORT
Deposited on 2002-05-02, released 2003-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c, iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-107)
      • engineered (76)
      • engineered (83)
      • engineered (106)
    Domains in SCOPe 2.05: d1lmsa_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lmsA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpakyipgtamafgglkkekdrndlitylkkate
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lmsA (A:)
    lfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlwdennmseyl
    tnpakyipgtamafgglkkekdrndlitylkkate