PDB entry 1lmr

View 1lmr on RCSB PDB site
Description: solution of ado1, a toxin from the assassin bugs agriosphodrus dohrni that blocks the voltage sensitive calcium channel l-type
Deposited on 2002-05-02, released 2003-08-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1lmra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmrA (A:)
    adddclprgskclgenkqcckgttcmfyanrcvgv