SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 1lmr

View 1lmr on RCSB PDB site
Description: Solution of ADO1, a Toxin from the Assassin Bugs Agriosphodrus dohrni that Blocks the Voltage Sensitive Calcium Channel L-type
Class: toxin
Keywords: ick, toxin
Deposited on 2002-05-02, released 2003-08-19
The last revision prior to the SCOP 1.75B freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: toxin ado1
Species: Agriosphodrus dohrni [TaxId:184613]
Domains in SCOP 1.75B: d1lmra_

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
```
>1lmrA (A:)
adddclprgskclgenkqcckgttcmfyanrcvgv
```