PDB entry 1lmr

View 1lmr on RCSB PDB site
Description: Solution of ADO1, a Toxin from the Assassin Bugs Agriosphodrus dohrni that Blocks the Voltage Sensitive Calcium Channel L-type
Class: toxin
Keywords: ick, toxin
Deposited on 2002-05-02, released 2003-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toxin ado1
  Species: Agriosphodrus dohrni [TaxId:184613]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P58608 (0-34)
  Domains in SCOPe 2.08: d1lmra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmrA (A:)
  adddclprgskclgenkqcckgttcmfyanrcvgv