PDB entry 1lmq

View 1lmq on RCSB PDB site
Description: the crystal structures of three complexes between chitooligosaccharides and lysozyme from the rainbow trout
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-10-25, released 1996-01-01
The last revision prior to the SCOP 1.75 freeze date was dated 1996-01-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Oncorhynchus mykiss
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11941 (0-128)
      • conflict (85)
    Domains in SCOP 1.75: d1lmqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmqA (A:)
    kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
    rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
    rsyvagcgv